PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca55352.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 172aa    MW: 18734.4 Da    PI: 8.6101
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca55352.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601475.2e-46131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+lal+++
  Dca55352.1  13 PCAACKLLRRRCAPDCVFAPYFPADEPQKFANVHRVFGASNVNKMLQELPVNQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQAQLALAQA 111
                 7**********************************************************************************************9997 PP

      DUF260 100 e 100
                 e
  Dca55352.1 112 E 112
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.41712113IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKENGRKQGA VAPCAACKLL RRRCAPDCVF APYFPADEPQ KFANVHRVFG ASNVNKMLQE  60
LPVNQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQAQLALAQ AEVVHLRMRQ  120
FGKPPHNHGT SSPDNSSPSS NKLMSSSSPP KSLFSMDMVV DQPNMGESLW SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667079.11e-104PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE93e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0J8DXN71e-104A0A0J8DXN7_BETVU; Uncharacterized protein
STRINGSolyc11g045530.1.13e-93(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-68LOB domain-containing protein 4